PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A04G1412
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 287aa    MW: 30716.9 Da    PI: 6.8634
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A04G1412genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding353.2e-111054244
                     SSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44
                      +W+ e d+ + +a + ++ +   +W++Ia+ ++ g+tl+++k+++
      Gh_A04G1412 10 SKWSREQDKAFENALATYPEDssdRWEKIAADVP-GKTLEEIKEHY 54
                     58********************************.**********9 PP

2Myb_DNA-binding42.12.1e-13119163347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT++E+ l++ +  ++G+g+W++I+r +  +Rt+ q+ s+ qky
      Gh_A04G1412 119 AWTEDEHRLFLLGLDKYGKGDWRSISRNFVVTRTPTQVASHAQKY 163
                      6*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129310.532762IPR017884SANT domain
SMARTSM007177.6E-10860IPR001005SANT/Myb domain
PfamPF002491.3E-81054IPR001005SANT/Myb domain
SuperFamilySSF466891.17E-111066IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-51155IPR009057Homeodomain-like
CDDcd001671.09E-91157No hitNo description
PROSITE profilePS5129417.581111168IPR017930Myb domain
SuperFamilySSF466891.2E-16114169IPR009057Homeodomain-like
TIGRFAMsTIGR015572.5E-17116166IPR006447Myb domain, plants
SMARTSM007173.2E-10116166IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-10119162IPR009057Homeodomain-like
CDDcd001677.73E-10119164No hitNo description
PfamPF002492.6E-11119163IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MTVEEADSSS KWSREQDKAF ENALATYPED SSDRWEKIAA DVPGKTLEEI KEHYELLEDD  60
VNRIESGCVP LPPYNSSESS AGDEGAGKKG SSHSGNCNSE SNHGSKNSRS DQERRKGIAW  120
TEDEHRLFLL GLDKYGKGDW RSISRNFVVT RTPTQVASHA QKYFIRLNSM NKDQRRSSIH  180
DITSVGNGDV SAPQGPITGQ SNGTASVGSA AKSTKQPLGH SVAPPGISVH GVPTMGQPIG  240
PLISAVGTPV NLPAPAHMAY GVRATLPGAV VPGAPVTYPM PYTSAHR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A9e-1812771176RADIALIS
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012459337.10.0PREDICTED: transcription factor DIVARICATA-like
RefseqXP_012459338.10.0PREDICTED: transcription factor DIVARICATA-like
RefseqXP_012459340.10.0PREDICTED: transcription factor DIVARICATA-like
RefseqXP_012459341.10.0PREDICTED: transcription factor DIVARICATA-like
RefseqXP_012459342.10.0PREDICTED: transcription factor DIVARICATA-like
RefseqXP_012459343.10.0PREDICTED: transcription factor DIVARICATA-like
RefseqXP_012459344.10.0PREDICTED: transcription factor DIVARICATA-like
RefseqXP_012459345.10.0PREDICTED: transcription factor DIVARICATA-like
RefseqXP_012459346.10.0PREDICTED: transcription factor DIVARICATA-like
RefseqXP_012459347.10.0PREDICTED: transcription factor DIVARICATA-like
RefseqXP_012459348.10.0PREDICTED: transcription factor DIVARICATA-like
RefseqXP_012459349.10.0PREDICTED: transcription factor DIVARICATA-like
RefseqXP_012459351.10.0PREDICTED: transcription factor DIVARICATA-like
RefseqXP_012459352.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H76e-67DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0B0PST50.0A0A0B0PST5_G
STRINGGLYMA07G28310.11e-160(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM35562861
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.11e-125MYB family protein